PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2190_a_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 67aa    MW: 7772.11 Da    PI: 10.6673
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2190_a_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.65.8e-32959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krienk+nrqvtf+kRrng+lKKA+ELS+LCdaev +iifss+gklye++s
  Neem_2190_a_2  9 KRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVGLIIFSSRGKLYEFCS 59
                   79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.983161IPR002100Transcription factor, MADS-box
CDDcd002653.59E-38266No hitNo description
SuperFamilySSF554557.33E-31264IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSILCD AEVGLIIFSS RGKLYEFCSN  60
SRSMVYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P1e-19165165Myocyte-specific enhancer factor 2B
1tqe_Q1e-19165165Myocyte-specific enhancer factor 2B
1tqe_R1e-19165165Myocyte-specific enhancer factor 2B
1tqe_S1e-19165165Myocyte-specific enhancer factor 2B
3kov_I1e-19265164Myocyte-specific enhancer factor 2A
3kov_J1e-19265164Myocyte-specific enhancer factor 2A
3mu6_A1e-19265164Myocyte-specific enhancer factor 2A
3mu6_B1e-19265164Myocyte-specific enhancer factor 2A
3mu6_C1e-19265164Myocyte-specific enhancer factor 2A
3mu6_D1e-19265164Myocyte-specific enhancer factor 2A
3p57_A1e-19265164Myocyte-specific enhancer factor 2A
3p57_B1e-19265164Myocyte-specific enhancer factor 2A
3p57_C1e-19265164Myocyte-specific enhancer factor 2A
3p57_D1e-19265164Myocyte-specific enhancer factor 2A
3p57_I1e-19265164Myocyte-specific enhancer factor 2A
3p57_J1e-19265164Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385889.19e-36hypothetical protein POPTR_0003s16800g
RefseqNP_001302424.12e-35MADS-box transcription factor isoform 2
RefseqXP_015075019.12e-35PREDICTED: MADS-box protein CMB1 isoform X3
RefseqXP_010499200.12e-35PREDICTED: developmental protein SEPALLATA 3 isoform X5
RefseqXP_010478050.12e-35PREDICTED: developmental protein SEPALLATA 3-like isoform X3
RefseqXP_010478048.12e-35PREDICTED: developmental protein SEPALLATA 3-like isoform X1
RefseqXP_010460481.13e-35PREDICTED: developmental protein SEPALLATA 3-like isoform X2
SwissprotQ034897e-36AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLA0A022QXX82e-36A0A022QXX8_ERYGU; Uncharacterized protein (Fragment)
TrEMBLA0A151RCR02e-36A0A151RCR0_CAJCA; Agamous-like MADS-box protein AGL9 isogeny
TrEMBLE9JPX32e-36E9JPX3_COFAR; MADS-box protein AGL2 subfamily
TrEMBLS8D4L41e-36S8D4L4_9LAMI; Uncharacterized protein
STRINGPOPTR_0003s16800.13e-35(Populus trichocarpa)
STRINGPOPTR_0004s11450.13e-35(Populus trichocarpa)
STRINGGSMUA_Achr8P28100_0016e-34(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.35e-37MIKC_MADS family protein